DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG34458

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:278 Identity:76/278 - (27%)
Similarity:126/278 - (45%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IHSTLLPDRSICGGDIA-YNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVT 159
            :||.:         |:| .::|..|......:|...|.|:...      |.:|.||||::..:||
  Fly    20 VHSDM---------DVAEESRIIGGQFAAPGQFPHQVSLQLNG------RHHCGGSLISDTMIVT 69

  Fly   160 AAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWN 224
            ||||.       .|....::...:|.::.||.    ||:      ...:.:..||..:..:....
  Fly    70 AAHCT-------MGQNPGQMKAIVGTNDLSAG----NGQ------TFNIAQFIIHPRYNPQSQDF 117

  Fly   225 DIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPG 289
            |::||:|:..|....:::.:.|..:.  .|:.:.....::|:|....:...|.::|    :.:..
  Fly   118 DMSLIKLSSPVPMGGAVQTIQLADSD--SNYAADTMAMISGFGAINQNLQLPNRLK----FAQVQ 176

  Fly   290 LCRRKYA---SIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRF 349
            |..|.|.   :|..|.|..:|| |...|  .||.|||||||..  :|  .|.|:||:|..||::.
  Fly   177 LWSRDYCNSQNIPGLTDRMVCA-GHPSGQVSSCQGDSGGPLTV--DG--KLFGVVSWGFGCGAKG 236

  Fly   350 WPAVYTNVLSYETWITQN 367
            .||:||.|.:..:||.||
  Fly   237 RPAMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 70/255 (27%)
Tryp_SPc 116..364 CDD:214473 68/252 (27%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 68/253 (27%)
Tryp_SPc 32..254 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.