DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:302 Identity:94/302 - (31%)
Similarity:126/302 - (41%) Gaps:73/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYR-PHDGQQLRTYCAGSLIN 153
            |||     .||.|  .|.||..|    |.|      .:.|||.|:.| .|       :|.|||||
Zfish    27 RPN-----PTLNP--RIVGGVNA----THG------AWPWMVSLQGRYGH-------FCGGSLIN 67

  Fly   154 NRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFG 218
            |::|:|||||:...|.:       .:.|.||:.. |.|.|.       ..:...:..|..|.|:.
Zfish    68 NQWVLTAAHCIVDQTPS-------SIIVYLGKWR-SYVADV-------NSISRTIRHIIPHPSYS 117

  Fly   219 TRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWG----------RTLTSE 273
            .....|||||::|...|.|:..|:|:||...  ..|:..|....|||||          |..|:.
Zfish   118 NITKDNDIALLQLTSTVQYTDYIKPICLADE--NSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTV 180

  Fly   274 SSPVKMKLRVTYVEPGLCRRKYASIVVLGDSH-----------LCAEGRSRGDSC-DGDSGGPLM 326
            |.|:.        .||:.:.....:....|.:           :||..|..|.:. .||||||||
Zfish   181 SVPLP--------HPGILQEAELKVYSNADCNNICHGRITPNMICAGTRPGGKATFSGDSGGPLM 237

  Fly   327 AFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368
            . ...|||..|::|.|..|.....|.|:..|..|:.|||.|:
Zfish   238 T-KCSVWVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 83/273 (30%)
Tryp_SPc 116..364 CDD:214473 80/270 (30%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 84/280 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.