powered by:
Protein Alignment CG11313 and si:dkeyp-93a5.2
DIOPT Version :9
Sequence 1: | NP_651821.3 |
Gene: | CG11313 / 43646 |
FlyBaseID: | FBgn0039798 |
Length: | 370 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021326346.1 |
Gene: | si:dkeyp-93a5.2 / 571079 |
ZFINID: | ZDB-GENE-131127-18 |
Length: | 130 |
Species: | Danio rerio |
Alignment Length: | 68 |
Identity: | 31/68 - (45%) |
Similarity: | 43/68 - (63%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 303 DSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWIT 365
|:.:|| |..:| |:|.||||||:::....|||..||:|.|.:||..:.|.|||.|..|:.||.
Zfish 39 DNMMCA-GLLQGGKDTCQGDSGGPMVSQQCSVWVQSGIISKGHDCGQPYEPGVYTRVSQYQNWIM 102
Fly 366 QNI 368
.:|
Zfish 103 SSI 105
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.