DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and prss60.2

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:285 Identity:82/285 - (28%)
Similarity:130/285 - (45%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVS 165
            |...::||.....::|..|.......:.|.|.|:...:.|.    :|.||||::.:|:|||||:.
Zfish    19 LSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGH----FCGGSLISSEWVLTAAHCLP 79

  Fly   166 AAT----------RARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTR 220
            ..:          |.::|         :..|.||.                .|.:|.:|.|:.:.
Zfish    80 GVSESSLVVYLGRRTQQG---------VNTHETSR----------------NVAKIIVHSSYNSN 119

  Fly   221 LFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQN--WQSGQAFTVAGWGRTLTSESSP---VKMK 280
            ...|||||:||:..|.::..||||||.:    ||  :.:|.:..:.|||......:.|   :..:
Zfish   120 TNDNDIALLRLSSAVTFNDYIRPVCLAA----QNSVYSAGTSSWITGWGDVQAGVNLPAPGILQE 180

  Fly   281 LRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGL 343
            ..:..|....|..:..|..|. ::.:|| |.::|  |:|.||||||::.....||:..||.|:|.
Zfish   181 TMIPVVANDRCNAQLGSGTVT-NNMICA-GLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITSWGY 243

  Fly   344 NCGSRFWPAVYTNVLSYETWITQNI 368
            .|.....|.|||.|..|::||:..|
Zfish   244 GCADPNSPGVYTRVSQYQSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 78/267 (29%)
Tryp_SPc 116..364 CDD:214473 76/264 (29%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 76/265 (29%)
Tryp_SPc 34..267 CDD:238113 78/267 (29%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.