DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG9733

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:421 Identity:194/421 - (46%)
Similarity:237/421 - (56%) Gaps:56/421 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVIAAVLLCLLIIRTAHGQYVS-CRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESR 64
            |||.|||.||:||...|..|..| |.||||..|.||.|..|..|.|||.::..||.|..||:.|.
  Fly     1 MKVFAAVFLCILIAHEAKAQSDSRCLNPNQTPGLCVLINECQTLYSVLKRATLTDQEKSFIKSSA 65

  Fly    65 CLVSDQSDLPFVCCTPDTDY------------------NTTRARPNDEVI--------------- 96
            | ....::.|:||||.||.|                  :....||...|.               
  Fly    66 C-GRGSNNQPYVCCTQDTGYVRIQRQDRTFPDYGAFGGDWEEERPQSFVFPRQERRPWSFGNQPA 129

  Fly    97 -------------HSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCA 148
                         .|:|||....|||....|:|..|.:|.:.||.||||||||...|..|.|.||
  Fly   130 TSRTPFRKSSTSDGSSLLPQPPSCGGVGIRNRIYDGQDTDVNEFPWMVLLEYRRRSGNGLSTACA 194

  Fly   149 GSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCL--NGRCLPEPVQIAVEEI 211
            |||||.|||:|||||::.......|.:   ||||||||:|...|||.  .|.|.||..::..|||
  Fly   195 GSLINRRYVLTAAHCLTGRIEREVGTL---VSVRLGEHDTRTAVDCPPGGGSCSPEVQRLGFEEI 256

  Fly   212 RIHESFGTRLF--WNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSES 274
            |:||.:..:..  .:||.|||:.|.|.||.:|:|:||||:|||::.||||.||||||||||....
  Fly   257 RVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMAR 321

  Fly   275 SPVKMKLRVTYVEPGLCRRKYASIVV-LGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGI 338
            |.||.|:.|.||:|..||::::.|.| |..:.|||.|:.|.||||||||||||.|.:..|||.||
  Fly   322 SAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQFRKDSCDGDSGGPLMRFRDESWVLEGI 386

  Fly   339 VSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369
            ||||..||.:.||.|||||.:|:.||.||:|
  Fly   387 VSFGYKCGLKDWPGVYTNVAAYDIWIRQNVR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 23/53 (43%)
Tryp_SPc 116..367 CDD:238113 138/255 (54%)
Tryp_SPc 116..364 CDD:214473 136/252 (54%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855 23/53 (43%)
Tryp_SPc 161..412 CDD:214473 136/253 (54%)
Tryp_SPc 162..415 CDD:238113 138/255 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447730
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0014395
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.