DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG9737

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:392 Identity:128/392 - (32%)
Similarity:180/392 - (45%) Gaps:64/392 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CRNPNQ-RTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLVSDQ------SDLPFVCCTPD 81
            |..||: :.|.|:.:..|.....|...:|....::.|:::.:|.|..|      |....|||..:
  Fly    28 CDIPNETKRGVCLEVSRCKAYLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQGSYESLVCCPAN 92

  Fly    82 -TDY--------------------NTTRARPNDEVIHSTLLPDRSI-----CGGDIAYNQITKGN 120
             .||                    ...|.:....:  .|:.|....     ||..:. |:|..|.
  Fly    93 GQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRI--QTVEPSSGFNLLNECGKQVT-NRIYGGE 154

  Fly   121 ETVLTEFAWMVLLEYRPHDGQQLRTY-CAGSLINNRYVVTAAHCVSA-ATRARKGDVSFRVSVRL 183
            ...|.||.|:.||.|..:|      | |:|:||::|:::||||||.. ..|.|:|    ...|||
  Fly   155 IAELDEFPWLALLVYNSND------YGCSGALIDDRHILTAAHCVQGEGVRDRQG----LKHVRL 209

  Fly   184 GEHNTSAVVDCLNG----RCLPEPVQIAVEEIRIHESFG--TRLFWNDIALIRLAREVAYSPSIR 242
            ||.|.....||:..    .|....:.||.|:|.:|..:.  :...:||||:|||...|:::..:.
  Fly   210 GEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVM 274

  Fly   243 PVCLPSTVGLQNWQSGQAFTVAGWGRT------LTSESSPVKMKLRVTYVEPGLCRRKYASI-VV 300
            |:|||:.........||.|:|:|||||      ..:..||:|:|||:.||....|.:..... |.
  Fly   275 PICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVR 339

  Fly   301 LGDSHLCAEGRSRGDSCDGDSGGPLMAF--HEGVWVLGGIVSFGL-NCGSRFWPAVYTNVLSYET 362
            ||...:||.|....|:|.||||||||.|  ....||..|:||:|. .||....|||||||..|..
  Fly   340 LGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTD 404

  Fly   363 WI 364
            ||
  Fly   405 WI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 14/60 (23%)
Tryp_SPc 116..367 CDD:238113 104/267 (39%)
Tryp_SPc 116..364 CDD:214473 102/265 (38%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 14/60 (23%)
Tryp_SPc 149..406 CDD:214473 102/266 (38%)
Tryp_SPc 150..409 CDD:238113 104/267 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457306
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.