DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and aqrs

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:238 Identity:52/238 - (21%)
Similarity:93/238 - (39%) Gaps:66/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 PHDGQQLRTY-----------CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSA 190
            |.|..:..||           |||:||:.|.|||:.||.    :.|:.|:.:..        |:.
  Fly    68 PFDATRDLTYYVNVLNEGSVICAGALISRRMVVTSTHCF----QPRRFDLIYEY--------TAK 120

  Fly   191 VVDCLNGRCL---PEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREV-----AYSPSIRPVCLP 247
            .:..|.|..|   |||.|:....:.::::   ..|.|.:||:.|:.::     .|.|..|     
  Fly   121 HLSILTGVELDDNPEPHQVIGFFMPVNKN---ERFTNYVALLALSNKLDRDKYRYIPLHR----- 177

  Fly   248 STVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRV---TYVEPGLCRRKYA-----SIVVLGDS 304
                 :..|:|....:|.:|        |.|.::|:   ..::...|:..|.     .:......
  Fly   178 -----KKPQAGDDVKMAYYG--------PPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPD 229

  Fly   305 HLCAEGR--SRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNC 345
            .:|...:  |:..:|....|.||:..::    |..|..:|.:|
  Fly   230 FICVRNKRHSKKTTCSTRPGDPLLIDNK----LAAINIYGEHC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 52/238 (22%)
Tryp_SPc 116..364 CDD:214473 52/238 (22%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 48/224 (21%)
Tryp_SPc 83..268 CDD:304450 47/221 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.