DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and SPE

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:396 Identity:137/396 - (34%)
Similarity:200/396 - (50%) Gaps:37/396 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLCLLIIRTAHG----------QYVSCRNPNQ--RTGYCVNIPLCVPLNSVLAKSNPTDSEMRFI 60
            ||..|::....|          .:.|| .|.|  ..|.||:|..|..|.::|.....|.::...:
  Fly     9 LLLSLVVSALSGLVHRSDAAEISFGSC-TPQQSDERGQCVHITSCPYLANLLMVEPKTPAQRILL 72

  Fly    61 RESRCLVSDQSD----LPFVCCTPDTDYNTTRARP----NDEVIHSTLLPDRSICGGDIAYNQIT 117
            .:|:|.:.::.:    ...|||......|...:.|    .|.:....:||...:||...| ::|.
  Fly    73 SKSQCGLDNRVEGLVNRILVCCPQSMRGNIMDSEPTPSTRDALQQGDVLPGNDVCGFLFA-DRIF 136

  Fly   118 KGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVR 182
            .|..|.|.||.|||||:|:....:.....|.|:|:|:|||:||.||:::....:.|.|..  |||
  Fly   137 GGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAGHCLASRELDKSGAVLH--SVR 199

  Fly   183 LGEHNTSAVVDC---LNGR--CLPEPVQIAVEEIRIHESFGTRLF--WNDIALIRLAREVAYSPS 240
            |||.:|....||   :||:  |.|:.:.|.||:..|||.:.....  .|||||:||.|.|:|:..
  Fly   200 LGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVDQRNDIALVRLKRIVSYTDY 264

  Fly   241 IRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASI-VVLGDS 304
            :||:|||:...:||........|||||.|...:.|.:|:|:.|.......|:.||:|. |.|.||
  Fly   265 VRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDDS 329

  Fly   305 HLCAEGRSRGDSCDGDSGGPLMA-FHEG---VWVLGGIVSFGLN-CGSRFWPAVYTNVLSYETWI 364
            .:||.|:...|:|.||||||||. ...|   |:.:.|:.|:|.. ||.:.||.|||...::..||
  Fly   330 QMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWI 394

  Fly   365 TQNIRP 370
            .|.:.|
  Fly   395 KQKLEP 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 14/59 (24%)
Tryp_SPc 116..367 CDD:238113 106/263 (40%)
Tryp_SPc 116..364 CDD:214473 104/260 (40%)
SPENP_651168.1 CLIP 42..94 CDD:314844 11/51 (22%)
Tryp_SPc 135..397 CDD:238113 106/263 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.