DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and SPE

DIOPT Version :10

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:83 Identity:21/83 - (25%)
Similarity:31/83 - (37%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 NLPGAVDWVMMQSCFGHHFMLVLEKQEKYDGHQQFYAIVQLIGSRKEAENFAYRLELNGNRRRLT 274
            :||....||:.      :..|....:.:||.......|.||.|.|........|.:|..:...|.
  Fly   585 DLPDGDQWVIF------NVELAGLYKVRYDRRNYQLIIAQLNGPRFGEIGLLNRAQLIDDAMDLA 643

  Fly   275 WEAMPRSIHEGVASAILN 292
            |....   :.|:|.|:||
  Fly   644 WTGQQ---NYGIAFAMLN 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:463440
Tryp_SPc 116..367 CDD:238113 21/83 (25%)
SPENP_651168.1 CLIP 36..94 CDD:463440
Tryp_SPc 135..397 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.