DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG16710

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:398 Identity:126/398 - (31%)
Similarity:181/398 - (45%) Gaps:62/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVIAAVLLCLLIIRT------AHGQYVSCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRF 59
            |..:..|.:..|::.|      |..:|..| |.:::   |:::..|..|...|...|.|.:|...
  Fly     1 MVFLQRVYISFLVLHTQLLMYLAESEYPPC-NLDEK---CISLARCTSLLPFLKPHNMTPAEKAV 61

  Fly    60 IRESRCLVSDQS----DLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGN 120
            ..:..|....:.    |...:||            ||    ...:||:..|||..:...:|..|.
  Fly    62 FEDRYCGYGPKGQELLDRVLICC------------PN----MGHILPNTQICGPIMPAYRIFGGE 110

  Fly   121 ETVLTEFAWMVLLEY----RPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSV 181
            ||...|..||.|:.|    |....::|.:.||||||.||||:|||||:      |...:..| .|
  Fly   111 ETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCL------RITGLDLR-RV 168

  Fly   182 RLGEHNTSAVVDC---LNGR--CLPEPVQIAVEEIRIHESFGTRLF----WNDIALIRLAREVAY 237
            ||||||..:..||   :|||  |.||.::|.|:....|..:  .:|    :|||||:||...|.|
  Fly   169 RLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHY--MVFEERPYNDIALLRLKFPVRY 231

  Fly   238 SPSIRPVCLPSTVGLQNWQ-SGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVL 301
            :..|:|:|:.......|.. |.....:||||.:.....|.|.::..|.......|.....|:.:.
  Fly   232 TAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEPSLGLD 296

  Fly   302 GDSHLCAEGRSRGDSCDGDSGGPLMAF-----HEGVWVLGGIVSFGLN-CGSRFWPAVYTNVLSY 360
            .::|:||......|:|.|||||||||.     .|.|: |.||.|:|.: ||  :.||.||....:
  Fly   297 KETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVY-LAGITSYGYSQCG--YGPAAYTKTSKF 358

  Fly   361 ETWITQNI 368
            ..||..|:
  Fly   359 VEWILWNM 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/57 (19%)
Tryp_SPc 116..367 CDD:238113 99/270 (37%)
Tryp_SPc 116..364 CDD:214473 97/267 (36%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 9/51 (18%)
Tryp_SPc 105..362 CDD:214473 97/268 (36%)
Tryp_SPc 106..362 CDD:238113 97/267 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.