DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG31199

DIOPT Version :10

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:176 Identity:53/176 - (30%)
Similarity:79/176 - (44%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 TEFAWMVLLEY-RPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNT 188
            ||..|:..:.| :..:|:.....|.|.|::.|.|:..|||.     .:...|:...||.||.||.
  Fly    48 TEHQWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCF-----VQYNGVAEAFSVHLGVHNK 107

  Fly   189 SAVVD---C-LNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPST 249
            ||.|.   | .:|.|:....:|.:.||.||..:.:|...|.:|::.|.|:....|::.|:|:|..
  Fly   108 SAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPP 172

  Fly   250 VGLQNWQSGQAFTVAG-----------WGRTLTSESSPVKMKLRVT 284
            ..|......|.|.|||           |..||:......|:|..||
  Fly   173 SLLNETLVAQTFVVAGLRVFEDFRLKTWVNTLSRGFCQSKVKTLVT 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:463440
Tryp_SPc 116..367 CDD:238113 53/176 (30%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:473915 53/176 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.