DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG31219

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:375 Identity:110/375 - (29%)
Similarity:169/375 - (45%) Gaps:52/375 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LCLLIIRTAHGQYVSCRNPNQRTGYCVNIP--LCVPLNSVLAKSNPTDSEMRFIRESRCLVSDQS 71
            |.::.|:.||.....| .|.::..|....|  .....:..|.:....|:.:.|.:.         
  Fly    10 LVVVFIQLAHSTNSDC-YPGEKYVYLYECPHVYTAGRSRTLMREYDMDAWLLFGQR--------- 64

  Fly    72 DLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYR 136
                :||.|          |.:.      ||...|||..::..::..|:|.....:.||.:|.|.
  Fly    65 ----ICCPP----------PGNR------LPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYL 109

  Fly   137 PHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEH----NTSAVVDC--L 195
            .....::..:|||||||||||:|:||||:...|    |:|.: |||||||    :.:...||  .
  Fly   110 NTTTLEILPFCAGSLINNRYVLTSAHCVNGIPR----DLSLK-SVRLGEHDITYDPAYNPDCRDQ 169

  Fly   196 NGRCLPEPVQIAVEEIRIH---ESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQS 257
            :.:|....::|.:|:|.:|   .|...|....||||:||...|.|...|.|:|:|.    ..:.:
  Fly   170 DNQCALPNLEIKLEKIIVHGLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPK----HGFFA 230

  Fly   258 GQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSG 322
            .....:||||:|...:.|.|.|...:......:|..::..:.:.....:||.|....|:|.||||
  Fly   231 KSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSG 295

  Fly   323 GPLMAFHEGVWV-LGGIVSFG-LNCGSRFWPAVYTNVLSYETWITQNIRP 370
            ||||...:...| |.||.::| .|||....|.:||...::..||...:||
  Fly   296 GPLMVTMDNSSVYLAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 7/55 (13%)
Tryp_SPc 116..367 CDD:238113 88/261 (34%)
Tryp_SPc 116..364 CDD:214473 86/258 (33%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 86/259 (33%)
Tryp_SPc 90..342 CDD:238113 88/260 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.