DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG7142

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:323 Identity:87/323 - (26%)
Similarity:136/323 - (42%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 STLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYR-----------------------PHD 139
            |..||....|||    .:......|:....|...|||.|                       ||.
  Fly    30 SIQLPTVRKCGG----GRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHS 90

  Fly   140 G------------QQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVV 192
            .            |.|..||||::||..:::|||||:| :.:|.:..|     :..|.|:    :
  Fly    91 APYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLS-SPQAVENSV-----IVAGSHD----I 145

  Fly   193 DCLNGRCLPEPVQIAVEEIRI---HESF--GTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGL 252
            ....|    |...|.:..|..   ||.:  |...:  |||||.....:.:...::|..||.    
  Fly   146 HDQKG----EASNIQMRHIDYYVRHELYLGGVNPY--DIALIYTKEPLVFDTYVQPATLPE---- 200

  Fly   253 QNWQSGQAFTVAGWGR-TLTS-ESSPVKM-KLRVTYVEPGLCRRKYA-SIVVLGDSHLCAEGRSR 313
            |:.|.....|:.|||. ::|: .:.|.:: :..:..::..||.:..| |.:.|.:::||....:.
  Fly   201 QDAQPEGYGTLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTG 265

  Fly   314 GDS-CDGDSGGPLMA------FHEGVWVLGGIVSFG-LNCGSRFWPAVYTNVLSYETWITQNI 368
            |.| |..||||||:.      |.:...|: ||||:| :.||.:..|:|:..|.::..||.|.|
  Fly   266 GVSICTADSGGPLIQQCCEEHFEQANIVI-GIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 79/302 (26%)
Tryp_SPc 116..364 CDD:214473 77/299 (26%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 73/262 (28%)
Tryp_SPc 84..323 CDD:214473 71/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.