DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG3505

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:365 Identity:122/365 - (33%)
Similarity:189/365 - (51%) Gaps:47/365 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSC--RNPNQR-TGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTD 83
            ::|  :.|:.| ||:|::|..|.....:|...|.:.|:...:|:::|.|.. :|:. ||| |.|.
  Fly    25 INCVAKIPSGRVTGHCISIRECDYFMRILLSGNLSQSDRNLLRDNQCGVRG-NDVQ-VCC-PSTA 86

  Fly    84 YNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCA 148
            .......|        |||  |.| |.:.: |.:...:|.:.||.|:.|:||...:.:::.. |.
  Fly    87 GLGALTHP--------LLP--SDC-GKVRW-QRSNDTDTRIREFPWLALIEYTRGNQEKIHA-CG 138

  Fly   149 GSLINNRYVVTAAHCVSAATRARKGDVSFRV-SVRLGEHNTSAVVDCLN------GRCLPEPVQI 206
            |.||::|||:||||||:.|..:     :.:: :|||||.:||...||..      ..|.|....|
  Fly   139 GVLISDRYVLTAAHCVAQAATS-----NLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDI 198

  Fly   207 AVEEIRIHESFG--TRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRT 269
            |:||:..|..:.  .|...|||||:|||.....:..::|:|||:.....:........||||   
  Fly   199 AIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGW--- 260

  Fly   270 LTSESSPVKMK---LRVTYVEPGLCRRKYASIVV-LGDSHLCAEGRSRGDSCDGDSGGPLMAFHE 330
              ..||..:|:   :.::.:|.  |:|||||..: :..|.||  |.:....|.|::|||||.|..
  Fly   261 --QASSSQRMRKGYVTISSIEE--CQRKYASQQLRIQASKLC--GLTNSQECYGNAGGPLMLFKN 319

  Fly   331 GVWVLGGIVSFG-LNCGSRFWPAVYTNVLSYETWITQNIR 369
            ..::|||:|||| :.|.:..||.|||.|.||..||..:::
  Fly   320 DGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDSLK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 16/56 (29%)
Tryp_SPc 116..367 CDD:238113 94/264 (36%)
Tryp_SPc 116..364 CDD:214473 92/261 (35%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 15/53 (28%)
Tryp_SPc 111..356 CDD:238113 94/259 (36%)
Tryp_SPc 111..354 CDD:214473 92/257 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.