DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG9649

DIOPT Version :10

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:114 Identity:24/114 - (21%)
Similarity:40/114 - (35%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VFLATDINLPGAVDWVMM---QSCFGHHFMLVLEKQEKYDGHQQFYAIVQLIGSRKEAENFAYRL 264
            :|..|.:::..|.:.:..   :.....|....:||:...   .:|...:..||.|          
  Fly   257 IFGETSMSVMNAANAIRSWEDRKAVAEHIHTYVEKKSLL---HEFVRKISNIGLR---------- 308

  Fly   265 ELNG----NRRRLTWEAMPRSIHEGVASAILNSDCLVFDTSIAQLFADN 309
            ||:|    .|:.|.|:|....|.|           :||......|:|.|
  Fly   309 ELSGFFGAARKPLPWDAKENQIFE-----------MVFPKLAVFLYATN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:463440
Tryp_SPc 116..367 CDD:238113 24/114 (21%)
CG9649NP_650343.1 GD_N 29..132 CDD:464985
Tryp_SPc 257..498 CDD:238113 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.