DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG8870

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:389 Identity:130/389 - (33%)
Similarity:176/389 - (45%) Gaps:73/389 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VIAAVLLCLLIIRTAHGQYVSCRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLV 67
            :|.:.||.|.||...:.....|:...:    |||:..|....:|:     ..|....|...||..
  Fly     5 LIGSFLLMLQIILVPYSNGAGCQFDTE----CVNLDKCPRTRAVM-----NSSRKNIIGLRRCGT 60

  Fly    68 SDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVL 132
            :.      |||            |..|    |.|| ...||.  :..:.|||....|.||.||.:
  Fly    61 NK------VCC------------PKWE----TYLP-HDTCGQ--SRRKPTKGKIPALNEFPWMAM 100

  Fly   133 LEY--RPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRV-SVRLGEHNTSAVVD- 193
            |.|  :.:..|:|...|.||||||.||:||||||.....    |..:.: :|||||||||...| 
  Fly   101 LLYGNKNNLSQKLVPKCGGSLINNWYVLTAAHCVEYPFM----DYPYALKTVRLGEHNTSTNPDR 161

  Fly   194 -CLNGR--CLPEPVQIAVEEIRIHESF--GTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQ 253
             .:|||  ..|..::|.|::|..||.|  |.||. |||||:||...|.|:.:|:|:|||....|.
  Fly   162 AIVNGRRQYAPLYMEIEVDQIITHEQFNRGRRLI-NDIALVRLKFPVRYTRAIQPICLPRAQKLA 225

  Fly   254 NWQSGQAFTVAGW---GRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGD 315
            ..:  :.|..:||   |:.:.||   |.::..:....|.:|:..|.  ..|| |.:||.|....|
  Fly   226 AHK--RKFQASGWPDMGQGIASE---VLLRSFIAERHPDVCKSNYD--FNLG-SQICAGGLDGND 282

  Fly   316 SCDGDSGGPLM-AFHEGVWVL---GGIVSFG------LNCGSRFWPAVYTNVLSYETWITQNIR 369
            :..|||||||| ....|...|   .||:|:|      ..|.    ||.||....:..||...::
  Fly   283 TSPGDSGGPLMETVIRGKVTLTYAAGIISYGQKPCVLKTCK----PAFYTKTSYFFEWIKSKLQ 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/53 (21%)
Tryp_SPc 116..367 CDD:238113 104/272 (38%)
Tryp_SPc 116..364 CDD:214473 102/269 (38%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 100/263 (38%)
Tryp_SPc 93..337 CDD:214473 98/260 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.