DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG3916

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:285 Identity:76/285 - (26%)
Similarity:123/285 - (43%) Gaps:52/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVV 158
            :|:.||......|.||.       :.||||    .:.|.|:.:.....|  .:|.||:::.::|:
  Fly    19 DVVTSTTESPTRINGGQ-------RVNETV----PFQVSLQMQRRGRWQ--HFCGGSIVSGQHVL 70

  Fly   159 TAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFW 223
            |||||:.                ::...:.|.||..||.:......::..:.:....|...|:. 
  Fly    71 TAAHCME----------------KMKVEDVSVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRII- 118

  Fly   224 NDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTV--AGWGRTLTSESS---PVKMK-LR 282
            |||||:::........|.....|   :|..: :.|:...|  .|||.|..|.||   |.::: |.
  Fly   119 NDIALVKVTPPFRLERSDISTIL---IGGSD-RIGEKVPVRLTGWGSTSPSTSSATLPDQLQALN 179

  Fly   283 VTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLM----AFHEGVWVLGGIVSFGL 343
            ...:....|.:|...:.   .:.:||.......:|.|||||||:    ..|     |.||||:|.
  Fly   180 YRTISNEDCNQKGFRVT---RNEICALAVQGQGACVGDSGGPLIRPGKQPH-----LVGIVSYGS 236

  Fly   344 NCGSRFWPAVYTNVLSYETWITQNI 368
            :..::..|.|||.|.|:..:|:|.|
  Fly   237 STCAQGRPDVYTRVSSFLPYISQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 68/260 (26%)
Tryp_SPc 116..364 CDD:214473 67/257 (26%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 70/268 (26%)
Tryp_SPc 31..260 CDD:238113 71/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.