DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG17404

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:291 Identity:80/291 - (27%)
Similarity:116/291 - (39%) Gaps:81/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSA 166
            |.|.:.|.||...:          ...:.|.|:||...||.  .:|.||:|....::|||||...
  Fly    32 PHRIVGGADIPPGE----------HVPYQVSLQYRTRGGQM--HFCGGSIIAPNRILTAAHCCQG 84

  Fly   167 ATRARKGDVSFRVSVR-LGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIR 230
            ...:|   :|....:| |.|..:.:                .|....||..: ..|..:|:|:: 
  Fly    85 LNASR---MSVVAGIRGLNEKGSRS----------------QVLSYSIHPKY-QELVTSDLAVL- 128

  Fly   231 LAREVAYSPSIRPVCLP-----STVGLQNWQS--------GQAFTVAGWGRTLTSESSPVKMKL- 281
                     ||:|   |     ||:....::|        |...|:.|||..|     ||.... 
  Fly   129 ---------SIKP---PLKLNNSTISAIEYRSQGKDFVGGGVPVTLTGWGLRL-----PVPFPFL 176

  Fly   282 ----------RVTY--VEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWV 334
                      |::|  :....||.  |.:..:.|:.:||.|..|| :|.|||||||:...:....
  Fly   177 DNVNYPNVLQRMSYHTISNSECRN--AGMESVTDTEICARGPFRG-ACSGDSGGPLVMESKNGLQ 238

  Fly   335 LGGIVSFGL-NCGSRFWPAVYTNVLSYETWI 364
            ..||||:|| .||....|.|||.|.::..||
  Fly   239 QVGIVSYGLVVCGLYISPDVYTRVSTFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 75/277 (27%)
Tryp_SPc 116..364 CDD:214473 73/275 (27%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 77/287 (27%)
Tryp_SPc 35..269 CDD:238113 76/286 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.