DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Prss45

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001008864.1 Gene:Prss45 / 408244 RGDID:1303021 Length:330 Species:Rattus norvegicus


Alignment Length:315 Identity:78/315 - (24%)
Similarity:120/315 - (38%) Gaps:83/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPH------ 138
            |:..||...|.|              :||..                 .|...||.|.|      
  Rat    33 PNLGYNEDHAEP--------------VCGAP-----------------WWSDSLEERHHWPWEVS 66

  Fly   139 ---DGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCL 200
               :.:.:   |.|:||:..:||:||||:       :|:..:  .|.||.       ..|.....
  Rat    67 LQIENEHV---CGGALIDQSWVVSAAHCI-------QGNKEY--LVMLGS-------STLQPSGS 112

  Fly   201 PEPVQIAVEEIRIHESF-GTRLFWNDIALIRLAREVAYSPSIRPVCLPS-----TVGLQNWQSGQ 259
            |..::|.|.:|.:|..: |.....:||||:.|...|.::..|:|:|||.     .||::.|    
  Rat   113 PWALKIPVGDIIMHPKYWGQNFIRSDIALLCLETPVTFNKYIQPICLPEHNFNLKVGMKCW---- 173

  Fly   260 AFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRK-----------YASIVVLGDSHLCAEGRSR 313
               |.|||:.....|:.:...|.:...|..:...|           |..::.|...::......|
  Rat   174 ---VTGWGQAKQHPSAKLTRSLELWEAEVSIVDNKNCDRVFHKKTFYPQVIPLIRKNMICTTNHR 235

  Fly   314 GDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368
            .:.|.||.||||.....|.|:|.||.|:...|......:|||.:..|..||.:.:
  Rat   236 ENPCYGDPGGPLACEVHGRWILAGIFSWEKACTKAPNLSVYTRIDKYTGWIKEQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 71/276 (26%)
Tryp_SPc 116..364 CDD:214473 69/273 (25%)
Prss45NP_001008864.1 Tryp_SPc 57..289 CDD:238113 68/257 (26%)
Tryp_SPc 57..286 CDD:214473 66/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.