DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG9372

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:370 Identity:110/370 - (29%)
Similarity:167/370 - (45%) Gaps:71/370 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YVSCRNPNQRTGYCVNIPLC-VP--LNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDT 82
            |.:|..|...:|.|.:|..| :|  .|.|          .|.:  |:..:.::|.:. :|||..:
  Fly    84 YGACSTPLGESGRCRHIIYCRMPELKNDV----------WRLV--SQLCIIEKSSIG-ICCTDQS 135

  Fly    83 DYN-----TTRARPNDE--VIHSTLLPDRSICG-GDIAYNQITKGNETVLTEFAWM--VLLEYRP 137
            ..|     ...:...||  :::.   |::..|| ....:.::|.|......|:.||  :|.|..|
  Fly   136 TSNRFSPQVVTSADGDEPRIVNK---PEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLP 197

  Fly   138 HDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPE 202
            .      .:|.|.||.:|:|:|||||:   .:..|.|    :.|||||:||    ..||      
  Fly   198 F------VWCGGVLITDRHVLTAAHCI---YKKNKED----IFVRLGEYNT----HMLN------ 239

  Fly   203 PVQIAVEEIRI-----HESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFT 262
              :....:.||     |..:..:.:.||||::|:.|...::..|.|||:|..  .::|....|. 
  Fly   240 --ETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPV--NEDWSDRNAI- 299

  Fly   263 VAGWG-RTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCA---EGRSRGDSCDGDSGG 323
            |.||| :......|.:.|::.:...:...||..:...|  .|:.:||   ||..  |||.|||||
  Fly   300 VTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHV--PDTAMCAGFPEGGQ--DSCQGDSGG 360

  Fly   324 PLMA-FHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQN 367
            ||:. .....||..||||:|:.||.|..|.:||.|..|..||..|
  Fly   361 PLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILAN 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 12/56 (21%)
Tryp_SPc 116..367 CDD:238113 87/262 (33%)
Tryp_SPc 116..364 CDD:214473 85/259 (33%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 13/57 (23%)
Tryp_SPc 173..402 CDD:214473 85/260 (33%)
Tryp_SPc 176..402 CDD:238113 84/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.