DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG4914

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster


Alignment Length:276 Identity:94/276 - (34%)
Similarity:129/276 - (46%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 CGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRAR 171
            ||.....::|..|..|.::|:.||..|.|..      |.||.|:|||:|||:||||||       
  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFN------RFYCGGTLINDRYVLTAAHCV------- 170

  Fly   172 KGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIR-IHESFGTRLFWNDIALIRLAREV 235
            ||.:.|.:.|..|||      |..|.:..||...:    :| ..:.|....|.|||||:||...|
  Fly   171 KGFMWFMIKVTFGEH------DRCNDKERPETRFV----LRAFSQKFSFSNFDNDIALLRLNDRV 225

  Fly   236 AYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSP--VKMKLRVTYVEPGLC--RRKYA 296
            ..:..|||:|||.....|:...|......||| ||..:..|  :..::.|..::...|  :..|.
  Fly   226 PITSFIRPICLPRVEQRQDLFVGTKAIATGWG-TLKEDGKPSCLLQEVEVPVLDNDECVAQTNYT 289

  Fly   297 SIVVLGDSHLCA--EGRSRGDSCDGDSGGPLMAFH------EGVWVLGGIVSFGLNCGSRFWPAV 353
            ..::. .:.:|:  .|....|||.|||||||:...      |.:    ||||:|..|....:|.|
  Fly   290 QKMIT-KNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQI----GIVSWGNGCARPNYPGV 349

  Fly   354 YTNVLSYETWITQNIR 369
            ||.|..|..||.:|.|
  Fly   350 YTRVTKYLDWIVENSR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 90/263 (34%)
Tryp_SPc 116..364 CDD:214473 88/260 (34%)
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 88/261 (34%)
Tryp_SPc 128..363 CDD:238113 90/263 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.