DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG4613

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:271 Identity:92/271 - (33%)
Similarity:130/271 - (47%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NQITKGNETVLTEFAWMVLLEYRPHDGQQLR---TYCAGSLINNRYVVTAAHCV------SAATR 169
            |:|..|.:....::.|:         .|.:|   .:|.|:|||:|||:||||||      ..:.|
  Fly   135 NRIVGGTQVRTNKYPWI---------AQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVR 190

  Fly   170 ARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLARE 234
            ..:.|   |.|..||...:.|......|.   :||.:      :|          ||||:||.:.
  Fly   191 LLQLD---RSSTHLGVTRSVAFAHAHVGY---DPVSL------VH----------DIALLRLDQP 233

  Fly   235 VAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSE---SSPVKMKLRVTYVEPGLCR-RKY 295
            :....::||.||||. .|||:...:|. |||||  |:.|   :|.|..::.|..:....|| ..|
  Fly   234 IPLVDTMRPACLPSN-WLQNFDFQKAI-VAGWG--LSQEGGSTSSVLQEVVVPIITNAQCRATSY 294

  Fly   296 ASIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVL 358
            .|::|  |:.:||.....|  |:|.|||||||:. .:.::.|.|:||||..|.....|.|||.|.
  Fly   295 RSMIV--DTMMCAGYVKTGGRDACQGDSGGPLIV-RDRIFRLAGVVSFGYGCAKPDAPGVYTRVS 356

  Fly   359 SYETWITQNIR 369
            .|..||..|.|
  Fly   357 RYLEWIAVNTR 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 89/265 (34%)
Tryp_SPc 116..364 CDD:214473 87/262 (33%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 87/263 (33%)
Tryp_SPc 137..362 CDD:238113 87/262 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.