DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG4477

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:322 Identity:75/322 - (23%)
Similarity:121/322 - (37%) Gaps:81/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 SDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEY 135
            |..|...|..|:..|.          .|:|...:.:..||...:.|...|..|          ..
  Fly    13 SFFPLYNCLGDSPRNA----------FSSLNRVKRLSDGDFDEDSIALSNYCV----------SL 57

  Fly   136 RPHDGQQL---RTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNG 197
            |....::.   ..:|:|.::...:|:|:|||:   ...|:..:|.||.:        .|...||.
  Fly    58 RSRSAEKFFGDNHFCSGVILAPMFVMTSAHCL---INKRRVLISSRVLL--------IVAGTLNR 111

  Fly   198 -RCLPEPVQIA-VEEIRIHESFGTRLFWN--DIALIRLAR---------EVAYSPSIRPVCLPST 249
             :.:|....:. |..|.:.:||..|   |  |..|:::..         .:|..|...|  ||  
  Fly   112 LKYIPNRTFVTPVTHIWLPDSFTMR---NKQDFGLLKVKNPFPRNNEHISIARLPVHPP--LP-- 169

  Fly   250 VGLQNWQSGQAFTVAGWGRTLTSESSPV---KMKLRVTYVEPGLCRR--KYASIVVLGDSHLCA- 308
                    |....|.||||..  :..|:   .:.:.|..::...|.:  :..|:     .|:|| 
  Fly   170 --------GLKCKVMGWGRMY--KGGPLASYMLYIDVQVIDSEACAKWLRVPSV-----EHVCAV 219

  Fly   309 --EGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368
              :..:....|.||.|.|::  |.|  .:.|||:....||....|::||||.|...||.:.|
  Fly   220 DSDDLTAQQPCGGDWGAPML--HNG--TVYGIVTILAGCGVSHLPSLYTNVHSNANWIHEKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 2/6 (33%)
Tryp_SPc 116..367 CDD:238113 65/274 (24%)
Tryp_SPc 116..364 CDD:214473 63/271 (23%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 63/267 (24%)
Tryp_SPc 55..273 CDD:214473 61/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.