DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG1299

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_647862.1 Gene:CG1299 / 38496 FlyBaseID:FBgn0035501 Length:511 Species:Drosophila melanogaster


Alignment Length:366 Identity:113/366 - (30%)
Similarity:168/366 - (45%) Gaps:41/366 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CRNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTR 88
            ||.|:.:.|.||.|..|..|.:.|...:...:...|:|.|..:..::...  |||........|.
  Fly   164 CRGPDTKPGNCVEIKECASLLNELRSRSQDATFANFLRASNAVCQNKGTQ--VCCPTGQGITNTT 226

  Fly    89 ARP------NDEVIHSTLLPDRSICGGDIAY-NQITKGNETVLTEFAWMVLLEYRPHDGQQLRTY 146
            ..|      |.:.|...||.....||..:.| .:|..|..:....:.|:.||.|....|...:  
  Fly   227 PAPSQIVPKNTDEIPRRLLNVEEGCGSTVGYFKKIVGGEVSRKGAWPWIALLGYDDPSGSPFK-- 289

  Fly   147 CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEI 211
            |.|:||..|:|:|||||:       :.|:.|   ||||||:.|  .|...|.     |.|.:...
  Fly   290 CGGTLITARHVLTAAHCI-------RQDLQF---VRLGEHDLS--TDTETGH-----VDINIARY 337

  Fly   212 RIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGL-QNWQSGQAFTVAGWGRTLT-SES 274
            ..|..:..|...:|:|::.|.|.|.::..|.|:|||.|..| |....|....|||||:|:. .||
  Fly   338 VSHPDYNRRNGRSDMAILYLERNVEFTSKIAPICLPHTANLRQKSYVGYMPFVAGWGKTMEGGES 402

  Fly   275 SPVKMKLRVTYVEPGLC------RRKYASIVVLGDSHLCAEGRSRG-DSCDGDSGGPLM--AFHE 330
            :.|..:|::...:..:|      .::|.|......:.|||...|.| |:|.||||||||  ..::
  Fly   403 AQVLNELQIPIYDNKVCVQSYAKEKRYFSADQFDKAVLCAGVLSGGKDTCQGDSGGPLMLPEPYQ 467

  Fly   331 GV--WVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369
            |.  :.|.|:||:|:.|.....|.||::...:..||.|.::
  Fly   468 GQLRFYLIGVVSYGIGCARPNVPGVYSSTQYFMDWIIQQVQ 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 14/53 (26%)
Tryp_SPc 116..367 CDD:238113 87/263 (33%)
Tryp_SPc 116..364 CDD:214473 85/260 (33%)
CG1299NP_647862.1 CLIP 37..93 CDD:197829
CLIP 164..216 CDD:288855 14/53 (26%)
Tryp_SPc 260..503 CDD:214473 85/261 (33%)
Tryp_SPc 261..503 CDD:238113 85/260 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.