DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and KLK1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:243 Identity:69/243 - (28%)
Similarity:103/243 - (42%) Gaps:55/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEI 211
            |.|.|::.::|:|||||:|.           ...:.||.||   :.|..|....     :.|.|.
Human    50 CGGILVHRQWVLTAAHCISD-----------NYQLWLGRHN---LFDDENTAQF-----VHVSES 95

  Fly   212 RIHESFGTRLFWN-----------DIALIRLAREV-AYSPSIRPVCLPSTVGLQNWQSGQAFTVA 264
            ..|..|...|..|           |:.|:||.... ..:.:::.|.||:    :..:.|.....:
Human    96 FPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPT----EEPEVGSTCLAS 156

  Fly   265 GWGR------TLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRG--DSCDGDS 321
            |||.      :...:...|.:|:    :....|::.:...|.  |..||. |...|  |:|.|||
Human   157 GWGSIEPENFSFPDDLQCVDLKI----LPNDECKKAHVQKVT--DFMLCV-GHLEGGKDTCVGDS 214

  Fly   322 GGPLMAFHEGVWVLGGIVSFG-LNCGSRFWPAVYTNVLSYETWITQNI 368
            |||||.  :|  ||.|:.|:| :.||:...|:|...||||..||...|
Human   215 GGPLMC--DG--VLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 68/240 (28%)
Tryp_SPc 116..364 CDD:214473 66/237 (28%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 68/240 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.