DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG9294

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:374 Identity:109/374 - (29%)
Similarity:155/374 - (41%) Gaps:118/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LPFV-----C--CTPDTDYNTTRARPND----EVIHSTLLPDRSI-------------------- 106
            ||::     |  |:..|:   .|.|||:    |.:.|.|||..:.                    
  Fly     3 LPWILIALFCGLCSGSTE---RRIRPNEGKIFEWLGSILLPSTTTTTSTPVVATTSTTTRRTTTT 64

  Fly   107 ---------------------------CGGDIAYNQITKGNETVLTEFAWM-VLLEYRPHDGQQL 143
                                       ||......:|..|.||.:.::.|| |:|.|.       
  Fly    65 SSTTSRTTTSRTTVANFPIERDCVTCRCGLINTLYKIVGGQETRVHQYPWMAVILIYN------- 122

  Fly   144 RTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAV 208
            |.||:|||||:.||:||||||       :|.....:::|..|||.|...|.:       .:|..|
  Fly   123 RFYCSGSLINDLYVLTAAHCV-------EGVPPELITLRFLEHNRSHSNDDI-------VIQRYV 173

  Fly   209 EEIRIHESFGTRLFWNDIALIRLAREV-AYSPSIRPVCLPSTVGLQNWQ-SGQAFTVAGWGR--- 268
            ..:::||.:..|.|.||:|::||.:.: .....:||:|||    :|::. ..:...|||||.   
  Fly   174 SRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLP----VQSYSFDHELGIVAGWGAQRE 234

  Fly   269 ------TLTSESSPV----KMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRG--DSCDGDS 321
                  ||......|    :.:...|| .||          .:.|:.:||...|.|  |:|.|||
  Fly   235 GGFGTDTLREVDVVVLPQSECRNGTTY-RPG----------QITDNMMCAGYISEGGKDACSGDS 288

  Fly   322 GGPLM-AFHE--GVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQN 367
            ||||. .|.|  |.:.|.||||:|:.|.....|.|||.|..|..|:..|
  Fly   289 GGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRWLGSN 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 3/11 (27%)
Tryp_SPc 116..367 CDD:238113 92/271 (34%)
Tryp_SPc 116..364 CDD:214473 91/268 (34%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 91/268 (34%)
Tryp_SPc 101..334 CDD:238113 91/268 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.