DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and tpr

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:391 Identity:111/391 - (28%)
Similarity:168/391 - (42%) Gaps:77/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LCLLIIRTAHGQYVSCRNPNQRTGY--CVNIPLCVPL-----NSVL--------AKSNPTDSEMR 58
            |||||...     :|| .|:|....  ..|.....||     |:.:        .:...:|||  
  Fly     6 LCLLICLA-----LSC-GPSQSASQDRATNQTAASPLLKQSQNTFIQWVLSLLPQRPGSSDSE-- 62

  Fly    59 FIRESRCLVSDQSDLPFVC-----CTPDTDYNTTRARPNDEVIHSTLLPDRS----ICGGDIAYN 114
              ..:...:|..|.:|...     .||....:||..|........||.|.|:    :||......
  Fly    63 --NATLATLSSSSMMPDAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCVCGIANIQK 125

  Fly   115 QITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRV 179
            :|..|.||.:.::.|:.:|.|..      |.|||.||:|:::::||:|||....:.       |:
  Fly   126 RIVGGQETEVHQYPWVAMLLYGG------RFYCAASLLNDQFLLTASHCVYGFRKE-------RI 177

  Fly   180 SVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPV 244
            ||||.||:..        ....:.:...|.|:..|..:..|.:.||||:|:|...|.::..:.||
  Fly   178 SVRLLEHDRK--------MSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPV 234

  Fly   245 CLPSTVGLQNWQSGQAF-----TVAGWGR-TLTSESSPVKMKLRVTYVEPGLCRR-KYASIVVLG 302
            |:|:        .|::|     .|.|||. .:...:|....:::|..:....||: :|.:.:.  
  Fly   235 CMPT--------PGRSFKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKIT-- 289

  Fly   303 DSHLCAEGRSRG--DSCDGDSGGPLMAFHEGV--WVLGGIVSFGLNCGSRFWPAVYTNVLSYETW 363
            |:.||. |...|  |||.|||||||.....|.  ..:.|:||:|..|....:|.||..|..|.||
  Fly   290 DNMLCG-GYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTW 353

  Fly   364 I 364
            |
  Fly   354 I 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 13/73 (18%)
Tryp_SPc 116..367 CDD:238113 81/260 (31%)
Tryp_SPc 116..364 CDD:214473 79/258 (31%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 79/259 (31%)
Tryp_SPc 127..356 CDD:238113 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.