DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG12133

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:346 Identity:112/346 - (32%)
Similarity:166/346 - (47%) Gaps:50/346 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VLAKSNPTDSEMRFIRESRCLVS----DQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSI 106
            :|...|.|:.:....|...|.::    :...:.|.||               .::....|||..:
  Fly     3 ILHPRNMTNDQKSQYRNKLCNINPFAHELVHMVFTCC---------------PMVAGDKLPDSRV 52

  Fly   107 CGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRT-YCAGSLINNRYVVTAAHCVSAATRA 170
            ||.....:.|..|.|....:|.|.|||.|..:..:|..: .||||||.:|||:|||||::..   
  Fly    53 CGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVN--- 114

  Fly   171 RKGDVSFRVS-VRLGEHNTSAVVDCL---NGRCLPEPVQIAVE-EIRI-HESFGTR--LFWNDIA 227
                 .|.|: ||||||:|....|..   ||..:..|..:.:: ::|: ||.:.||  ..:||||
  Fly   115 -----DFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIA 174

  Fly   228 LIRLAREVAYSPSIRPVCL-P----STVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVE 287
            |:||...|.|:..|||:|: |    ||...:|:    .|.:||||.:...:.|.|..:..::.:.
  Fly   175 LLRLKSRVKYTLQIRPICIWPGIELSTSSFKNF----PFQIAGWGDSGLQQKSTVLRQGTISGMS 235

  Fly   288 PGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAF----HEGVWVLGGIVSFGLNCGS- 347
            |..|..:|.:::|..|..:||.|....|:..||||.||||.    .:..:.|.||.|:|....| 
  Fly   236 PDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSY 300

  Fly   348 RFWPAVYTNVLSYETWITQNI 368
            .:.|||||...||..||.:.|
  Fly   301 GYGPAVYTKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 6/35 (17%)
Tryp_SPc 116..367 CDD:238113 98/269 (36%)
Tryp_SPc 116..364 CDD:214473 96/266 (36%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 98/269 (36%)
Tryp_SPc 62..317 CDD:214473 96/266 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.