DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG8172

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:260 Identity:93/260 - (35%)
Similarity:132/260 - (50%) Gaps:26/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFR 178
            |:|..|:.|......|.|.|.......::|.  |.|:||:||:|:||||||::...:       .
  Fly   314 NRIVGGHSTGFGSHPWQVALIKSGFLTRKLS--CGGALISNRWVITAAHCVASTPNS-------N 369

  Fly   179 VSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRP 243
            :.:||||.:.....:.||..      :..:|...:|..:....|.||:|||||.|.|.|...|.|
  Fly   370 MKIRLGEWDVRGQEERLNHE------EYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIP 428

  Fly   244 VCL-PSTVGLQNWQSGQAFTVAGWGRTLTSESS--PVKMKLRVTYVEPGLCRRKYASI---VVLG 302
            ||| |||..|    :|:..||||||||...:|:  .|..::.|..:....|:|.:.:.   ..:.
  Fly   429 VCLPPSTTKL----TGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIH 489

  Fly   303 DSHLCAEGRSRG-DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQ 366
            |..|||..:..| |||.|||||||....:|...|.|:||:|:.||....|.||||:..:..||.:
  Fly   490 DVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 554

  Fly   367  366
              Fly   555  554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 92/258 (36%)
Tryp_SPc 116..364 CDD:214473 90/254 (35%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 90/255 (35%)
Tryp_SPc 316..555 CDD:238113 92/258 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.