DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and flz

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:366 Identity:101/366 - (27%)
Similarity:160/366 - (43%) Gaps:62/366 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RNPNQRTGYCVNIPLCVPLNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTP---DTDYNT 86
            :.|.:|....|.       .:.::.:.|.|.|          :.|:.|...|...|   :.|...
  Fly  1357 KKPTRRVSSTVK-------TTTVSSARPADDE----------IVDEEDEEDVNPNPSDNEIDQGA 1404

  Fly    87 TRAR---PNDEVIHST--LLPDRSI--------CG--GDIAYNQITKGNETVLTEFAWMVLLEYR 136
            |.:.   .|...||||  .||..::        ||  ..:...:|..|..:....:.|.||:...
  Fly  1405 TLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECGVRPHVKSGRIVGGKGSTFGAYPWQVLVRES 1469

  Fly   137 PHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLP 201
            ...|...:..|.|.||.:|||:|||||       :.|.::..|:| :||.:.|..::.      .
  Fly  1470 TWLGLFTKNKCGGVLITSRYVITAAHC-------QPGFLASLVAV-MGEFDISGDLES------K 1520

  Fly   202 EPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGW 266
            ..|...|:.:.:|..:....|.||:||:.|...|.:...|.|:|:|:.|.   ..:|:..||.||
  Fly  1521 RSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMPNDVA---DFTGRMATVTGW 1582

  Fly   267 GRTLTSESSP-VKMKLRVTYVEPGLCRRKYASI----VVLGDSHLCAEGRSRG--DSCDGDSGGP 324
            ||.......| |..:::|..:|..:|:..:.:.    .:| .|.||| |.:.|  |||:||||||
  Fly  1583 GRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKIL-TSFLCA-GYANGQKDSCEGDSGGP 1645

  Fly   325 LMAFH-EGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWI 364
            |:... :|.:.|.|.||.|:.|.:.:.|.||.....|:.|:
  Fly  1646 LVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 9/52 (17%)
Tryp_SPc 116..367 CDD:238113 80/257 (31%)
Tryp_SPc 116..364 CDD:214473 79/255 (31%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 80/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.