DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG8586

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:375 Identity:108/375 - (28%)
Similarity:157/375 - (41%) Gaps:72/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PNQRTGY---CVNIPLC---VPLNSVLAKSNPTDSEMRFIRE-SRCLVSDQ----SDLPFVCCTP 80
            ||:..|.   ||...||   :..:|.::..||..|.::..:. .||...||    |:.|::....
  Fly   101 PNESCGQNMECVPRKLCRDNIINDSGISLINPRISPIQCSKSLYRCCAVDQKVDDSESPYLVKQA 165

  Fly    81 DTDY-NTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLR 144
            :..| |...:.|..      |:||..    ...|::    :.::..||.|||.:    ..|:| .
  Fly   166 NFKYKNCGYSNPKG------LIPDND----KFPYSE----DVSIFGEFPWMVGI----FTGRQ-E 211

  Fly   145 TYCAGSLINNRYVVTAAHCVSAAT----RARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQ 205
            ..|.|:||:.|.|||.:|.:...|    .||.||..                  ||....|.|.|
  Fly   212 FLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWD------------------LNSLNEPYPHQ 258

  Fly   206 -IAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCL--PSTVGLQNWQSGQAFTVAGWG 267
             ..::||.:|..|.....:|||||:.|...:..:|.|:|:||  |.:..|.|..........|||
  Fly   259 GSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWG 323

  Fly   268 RTLTSESSPVKM-----KLRVTYVEPGLCRRKYASIVV-----LGDSHLCAEGRSRGDSCDGDSG 322
               |.|:...|:     ::.:..||...|:.|..:..:     |..|.:||.|....|:|.||.|
  Fly   324 ---TKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGG 385

  Fly   323 GPLMAFHEGV---WVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369
            .||.....|.   :.|.||||:|:.|.....||||.||.....||.:.||
  Fly   386 SPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 17/61 (28%)
Tryp_SPc 116..367 CDD:238113 82/270 (30%)
Tryp_SPc 116..364 CDD:214473 80/267 (30%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 82/261 (31%)
Tryp_SPc 197..430 CDD:214473 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.