DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and SPH93

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:310 Identity:91/310 - (29%)
Similarity:135/310 - (43%) Gaps:45/310 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PDTDY-NTTR--ARPNDEVIHSTLLPDRSICGGDIAYN-QITKG---NETVLTEFAWMVLLEYRP 137
            |.|:: |.|.  ..|...|..|.||...  ||...|.. |:.:|   ::....::.|.|.:.   
  Fly   205 PTTNFGNPTNNGGNPTTNVGSSELLSPS--CGMSNANGLQMVEGITIDQARPAQYPWAVAIF--- 264

  Fly   138 HDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPE 202
            |:||.|   ..||||....|:|.||.|..        :...:.||.|:.      |..:.|.:..
  Fly   265 HNGQYL---AGGSLIQPNVVLTVAHRVIT--------IETELVVRAGDW------DLKSDREIFL 312

  Fly   203 PVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWG 267
            ..|..||...|||.|..:...|::||:.|......:..||.:|||:.   ....:|:..||||||
  Fly   313 SEQREVERAVIHEGFDFKSGANNLALLFLNSPFKLNDHIRTICLPTP---NKSFAGRRCTVAGWG 374

  Fly   268 RTLTSES--SPVKMKLRVTYVEPGLCRRKYASIVVLG------DSHLCAEGRSRGDSCDGDSGGP 324
            :....:.  |.|..|:::..|...:| .|:.....||      .:.:||.|....|:|.||.|..
  Fly   375 KMRYEDQRYSTVLKKVQLLVVNRNVC-EKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSA 438

  Fly   325 LMAF----HEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIRP 370
            |...    :.||:...|||::|:.||....||:||.|..:..|||:.:.|
  Fly   439 LFCSIGGENSGVYEQAGIVNWGVGCGQEGIPAIYTEVSKFTNWITEKLLP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 77/265 (29%)
Tryp_SPc 116..364 CDD:214473 74/262 (28%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 76/258 (29%)
Tryp_SPc 252..482 CDD:214473 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.