DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG4793

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:360 Identity:88/360 - (24%)
Similarity:143/360 - (39%) Gaps:99/360 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IRESRCLVSDQSDLPFV-----------------CCTPDTDYNTTRARPNDEVIHSTLLPDR--- 104
            ::.:||.:..::..|.:                 ||            |..|::...:..|.   
  Fly    30 VQRNRCRIGTETGRPIIDFRGLNNGNQGCESGQTCC------------PKTEILQYPVQADNQPL 82

  Fly   105 -SICG--------------GDIAYNQITKGNETVLTEFAWMV-LLEYR---PHDGQQLRTYCAGS 150
             :.||              .|||    .||      |..||| ||:.|   |..|        ||
  Fly    83 PTECGHVNRIGVGFTITNARDIA----QKG------ELPWMVALLDSRSRLPLGG--------GS 129

  Fly   151 LINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPV--QIAVEEIRI 213
            ||....|:|      ::|:..:....:.: ||.||.:..::.:        |..  .:|:.:|..
  Fly   130 LITRDVVLT------SSTKTLEVPEKYLI-VRAGEWDFESITE--------ERAHEDVAIRKIVR 179

  Fly   214 HESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVK 278
            |.:.......|:.||:.|||.:.....|..:|||..  .:|:...:.. |:|||:....::|.:.
  Fly   180 HTNLSVENGANNAALLFLARPLKLDHHIGLICLPPP--NRNFIHNRCI-VSGWGKKTALDNSYMN 241

  Fly   279 M--KLRVTYVEPGLCRRK----YASIVVLGDSHLCAEGRSRGDSCDGDSGGPL---MAFHEGVWV 334
            :  |:.:..|:..:|:.|    |....:|.:|.:||.|....|:|.||.|.||   :......:.
  Fly   242 ILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYE 306

  Fly   335 LGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369
            |.|||:||..||... ||.||:|....:||...|:
  Fly   307 LLGIVNFGFGCGGPL-PAAYTDVSQIRSWIDNCIQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 3/34 (9%)
Tryp_SPc 116..367 CDD:238113 74/265 (28%)
Tryp_SPc 116..364 CDD:214473 72/262 (27%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 75/268 (28%)
Tryp_SPc 105..335 CDD:214473 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.