DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG18477

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:403 Identity:107/403 - (26%)
Similarity:163/403 - (40%) Gaps:104/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VIAAVLLCLLIIRT-AHGQYV----SCRNPNQ---------------------RTGYCVNIPLCV 41
            :||.|.|.|:..:. |.||..    ||...|:                     |...||:..:|.
  Fly     7 IIAIVSLILVAGQVQAQGQNAELNQSCGASNEHQCVPRHMCKVKIEFRMAMTYRNLGCVSTAICC 71

  Fly    42 PLNSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYNTTRARPNDEVIHSTLLPDRSI 106
            |.|.:             |:|.|.::::          |.||       |....::|.       
  Fly    72 PKNLI-------------IKEPRLIINE----------PITD-------PQCGFVNSK------- 99

  Fly   107 CGGDIAYNQITKGNETVL---TEFAWMV-LLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAA 167
             |...::.:    .:|.|   .|..||| ||:.|      ..:|.||.      .:.|.|.|..|
  Fly   100 -GVTFSFRE----EDTGLAQEAEVPWMVALLDAR------TSSYVAGG------ALIAPHVVITA 147

  Fly   168 TRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLA 232
            .:..:...:.::.||.||.:.|...:.|      ..|.:.:..|..|..|......|::||:.|.
  Fly   148 RQRTENMTASQLVVRAGEWDFSTKTEQL------PSVDVPIRSIVRHPGFNLENGANNVALVFLR 206

  Fly   233 REVAYSPSIRPVCLPSTVGLQNWQSGQA-FTVAGWGRTLTSESS--PVKMKLRVTYVEPGLCRRK 294
            |.:..|..|.|:|:||..  :|:...:. ||  |||:....:.|  .|..|:.:..|:...|.::
  Fly   207 RSLTSSRHINPICMPSAP--KNFDFSRCIFT--GWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQ 267

  Fly   295 ----YASIVVLGDSHLCAEGRSRGDSCDGDSGGPL-MAFHEGV--WVLGGIVSFGLNCGSRFWPA 352
                |.:...|.:|.:||.|....|||:||.|.|| .|..:..  :.|.|||:||::||....||
  Fly   268 LRLYYGNDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQRYELAGIVNFGVDCGLPGVPA 332

  Fly   353 VYTNVLSYETWIT 365
            |||||.:...|||
  Fly   333 VYTNVANVIEWIT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/74 (15%)
Tryp_SPc 116..367 CDD:238113 81/264 (31%)
Tryp_SPc 116..364 CDD:214473 78/261 (30%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 76/252 (30%)
Tryp_SPc 113..344 CDD:238113 76/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.