DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:302 Identity:100/302 - (33%)
Similarity:151/302 - (50%) Gaps:36/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVL-------TEFAWMVLLEYR 136
            :|.|...||| ||.... .|..||.:  ||..   |.:|...|.::       .||.|:.:|.  
  Fly   363 SPVTTTTTTR-RPVSGT-SSEGLPLQ--CGNK---NPVTPDQERIVGGINASPHEFPWIAVLF-- 418

  Fly   137 PHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLP 201
             ..|:|   :|.||||.|.:::||||||:   |....||: .::..||::|.....:.       
  Fly   419 -KSGKQ---FCGGSLITNSHILTAAHCVA---RMTSWDVA-ALTAHLGDYNIGTDFEV------- 468

  Fly   202 EPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQ-SGQAFTVAG 265
            :.|...::.:..|:.|......||:|::.|:..|.::..|:|:|||::...|:.. |||..||||
  Fly   469 QHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQQSRSYSGQVATVAG 533

  Fly   266 WGRTLTSESSP-VKMKLRVTYVEPGLCRRKYASIVVLG--DSHLCAEGRSRGDSCDGDSGGPLMA 327
            ||....:...| :..|:.:.......|.|||......|  :|.:|| |::..|||.||||||::.
  Fly   534 WGSLRENGPQPSILQKVDIPIWTNAECARKYGRAAPGGIIESMICA-GQAAKDSCSGDSGGPMVI 597

  Fly   328 FHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369
            ...|.:...||||:|:.||...:|.|||.|.|...||.:||:
  Fly   598 NDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKNIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 85/261 (33%)
Tryp_SPc 116..364 CDD:214473 83/258 (32%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 81/252 (32%)
Tryp_SPc 400..637 CDD:238113 83/254 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.