DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG18557

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:379 Identity:96/379 - (25%)
Similarity:132/379 - (34%) Gaps:130/379 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VSCRNPNQRTGYCVN----IPLCVPLNSVLAKSNP-----TDSEMRFIRESRCLVSDQSDLPFVC 77
            :|..:|.||:..|.:    :.:..|||  ..||||     |..|          |.||       
  Fly    44 ISWPSPCQRSESCCHSSQKLVIGAPLN--CGKSNPNGLGGTVEE----------VVDQ------- 89

  Fly    78 CTPDTDYNTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQ 142
                       |:||                                 ||.|.|.|..     ..
  Fly    90 -----------AKPN---------------------------------EFPWTVALMQ-----NL 105

  Fly   143 LRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIA 207
            :..:.||:|:....|:||||.:...|....|.:.....::                      |:|
  Fly   106 INFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLK----------------------QLA 148

  Fly   208 VEEI------RI--HESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAF--- 261
            .:.|      ||  |..|......|:||||.|.......|.|.|:|.|:        ||.:|   
  Fly   149 GKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPT--------SGVSFDRE 205

  Fly   262 --TVAGWGRT--LTSESSPVKMKLRVTYVEPGLC-----RRKYASIVVLGDSHLCAEGRSRGDSC 317
              .||||||.  |....|..:.|:.:..|....|     |..:.....|..:.|||.|....|:|
  Fly   206 RCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDAC 270

  Fly   318 DGDSGGPLMA---FHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368
            .||.|.|||.   .|..::.|.|||:.|.:||....||:|||:.....||.:.:
  Fly   271 IGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 16/62 (26%)
Tryp_SPc 116..367 CDD:238113 76/273 (28%)
Tryp_SPc 116..364 CDD:214473 74/270 (27%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 81/320 (25%)
Tryp_SPc 90..320 CDD:214473 77/297 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.