DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Ser6

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:127/281 - (45%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRT----YCAGSLINNRYVVTA 160
            :||.:|..|.  ...::..|.:.|..:|         ||. ..||.    .|.||::...|::||
  Fly    18 VLPVQSAPGK--LNGRVVGGEDAVKNQF---------PHQ-VSLRNAGSHSCGGSILTRTYILTA 70

  Fly   161 AHCVSAATRARKGDVSF--------RVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESF 217
            |||||      ..||:.        |.::|.|.:      |..:|..|   ||:|  |:.:||.:
  Fly    71 AHCVS------NEDVNHVITPIAAERFTIRAGSN------DRFSGGVL---VQVA--EVIVHEEY 118

  Fly   218 GTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLR 282
            |.  |.||:||:||...:..|.||:|:.||:.    :..:.....::||||.......|..::..
  Fly   119 GN--FLNDVALLRLESPLILSASIQPIDLPTV----DTPADVDVVISGWGRIKHQGDLPRYLQYN 177

  Fly   283 VTYVEPGLCRRKYASIVVLG-DSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCG 346
            ..   ..:.|::...::..| :..||...:....:|:||||||.:..::.|.|.|.:|.   .||
  Fly   178 TL---KSITRQQCEELIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVD---GCG 236

  Fly   347 SRFWPAVYTNVLSYETWITQN 367
            |.: |..|..|..::.||.::
  Fly   237 STY-PDGYARVFYFKDWIKKH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 74/263 (28%)
Tryp_SPc 116..364 CDD:214473 72/260 (28%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 72/261 (28%)
Tryp_SPc 32..256 CDD:238113 74/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.