DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG14227

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:232 Identity:74/232 - (31%)
Similarity:109/232 - (46%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 CAGSLINNRYVVTAAHCVSAATRARKGDVSFR--VSVRLGEHNT-SAVVDCLNGRCLPEPVQIAV 208
            |:|||||:|:|:||||||            ||  :.|.||:.:. :...:|.:|..|.....:.:
  Fly    70 CSGSLINHRFVLTAAHCV------------FREAMQVHLGDFDAWNPGQNCSSGARLSNAYCVRI 122

  Fly   209 EEIRIHESFG-TRLFWNDIALIRLAREVAYSPSIRPVCL---PSTVGLQNWQSGQAFTVAGWGRT 269
            ::..:|..|| .:....||.|:|:...|.||..:||:||   .....:..:|    .||  ||.|
  Fly   123 DKKIVHAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEPVAAIDRFQ----LTV--WGTT 181

  Fly   270 LTS-ESSPVKMKLRV-TYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMA--FHE 330
            ... .|.|..:|..| ..::..||..|:...|  .:|.:|....: ..:|.||||||..|  .:.
  Fly   182 AEDFRSIPRVLKHSVGDRIDRELCTLKFQQQV--DESQICVHTET-SHACKGDSGGPFSAKILYG 243

  Fly   331 GVW--VLGGIVSFGL-NCGSRFWPAVYTNVLSYETWI 364
            |.:  ...||:.||| :|...   :|.|||..|..||
  Fly   244 GTYRTFQFGIIIFGLSSCAGL---SVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 74/232 (32%)
Tryp_SPc 116..364 CDD:214473 72/230 (31%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 72/230 (31%)
Tryp_SPc 57..277 CDD:238113 72/230 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.