DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG32260

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:412 Identity:120/412 - (29%)
Similarity:169/412 - (41%) Gaps:98/412 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SCRNPNQRTGYCVNIPLCVPL-NSVLAKSNPTDSEMRFIRESRCLVSDQSDLPFVCCTPDTDYN- 85
            ||::...|.|.|:.:..|..| .....::|...:   |:.:|.|.....:.:  |||..|...| 
  Fly   193 SCQDARSRPGSCLPLTSCPQLMQEYQGQANEFHT---FLGQSICGFDGSTFM--VCCATDRSGNA 252

  Fly    86 --------TTRA------------------------RPNDEVIHSTLLP------------DRSI 106
                    ||.|                        .|..:|:..:..|            :.:.
  Fly   253 RSRKDVFVTTAAPFGFFHFSPLSGGSTATPMVFQPTPPLSQVVSPSFYPPPPPPPPNNAPRESAT 317

  Fly   107 CG-GDIAYNQITKGNETVLTEFAWMVLLEY-RPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATR 169
            || .....|::..|.|.....:.|:..|.| ..::...|:..|.||||::|||:|:|||::    
  Fly   318 CGISGATSNRVVGGMEARKGAYPWIAALGYFEENNRNALKFLCGGSLIHSRYVITSAHCIN---- 378

  Fly   170 ARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRI-----HESFGTRLFWNDIALI 229
                  .....||||.|:            |.:|.:....::||     ||.|......||||||
  Fly   379 ------PMLTLVRLGAHD------------LSQPAESGAMDLRIRRTVVHEHFDLNSISNDIALI 425

  Fly   230 RLAREVAYSPSIRPVCLPSTVGL--QNWQSGQAFTVAGWG----RTLTSESSPVKMKLRVTYVEP 288
            .|....|...:|.|:|||.....  |::.....| |||||    :.:||:   |....:|..|..
  Fly   426 ELNVVGALPGNISPICLPEAAKFMQQDFVGMNPF-VAGWGAVKHQGVTSQ---VLRDAQVPIVSR 486

  Fly   289 GLCRRKYASI---VVLGDSHLCAEGRSRGDSCDGDSGGPLMAFH-EG---VWVLGGIVSFGLNCG 346
            ..|.:.|.||   |...|..||| |.|..|:|.||||||||... ||   .:.|.|:||||..|.
  Fly   487 HSCEQSYKSIFQFVQFSDKVLCA-GSSSVDACQGDSGGPLMMPQLEGNVYRFYLLGLVSFGYECA 550

  Fly   347 SRFWPAVYTNVLSYETWITQNI 368
            ...:|.|||.|.||..||.::|
  Fly   551 RPNFPGVYTRVASYVPWIKKHI 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 11/54 (20%)
Tryp_SPc 116..367 CDD:238113 94/269 (35%)
Tryp_SPc 116..364 CDD:214473 92/266 (35%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855 11/54 (20%)
Tryp_SPc 327..568 CDD:214473 92/267 (34%)
Tryp_SPc 328..571 CDD:238113 94/269 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.