DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:271 Identity:83/271 - (30%)
Similarity:127/271 - (46%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 AYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVS 176
            |.::|..|:......:.|...|..     |::.. |.|||::..:|:|||||.|.:..:...:|.
  Rat    26 AGSRIVGGHAAQAGAWPWQASLRL-----QKVHV-CGGSLLSPEWVLTAAHCFSGSVNSSDYEVH 84

  Fly   177 F-RVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESF-GTRLFWNDIALIRLAREVAYSP 239
            . .:::.|..|.::                  |::|.::.|. |......||||::||..||.|.
  Rat    85 LGELTITLSPHFST------------------VKQIIMYSSAPGPPGSSGDIALVQLATPVALSS 131

  Fly   240 SIRPVCLPST-----VGLQNWQSGQAFTVAGWGRTLTSESSPVK-----MKLRVTYVEPGLCRRK 294
            .::|||||..     .|:|.|       |.|||  .|.|..|:|     .:.:|:.|:...|.:.
  Rat   132 QVQPVCLPEASADFHPGMQCW-------VTGWG--YTQEGEPLKPPYNLQEAKVSVVDVETCSQA 187

  Fly   295 YASI--VVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNV 357
            |:|.  .::....|||.|  .||:|..||||||:....|:|...|:||:|..||....|.||..|
  Rat   188 YSSSNGSLIQSDMLCAWG--PGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARV 250

  Fly   358 LSYETWITQNI 368
            .:|..||.::|
  Rat   251 TAYVNWIHRHI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 81/264 (31%)
Tryp_SPc 116..364 CDD:214473 79/261 (30%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 79/262 (30%)
Tryp_SPc 30..260 CDD:238113 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.