DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:289 Identity:91/289 - (31%)
Similarity:129/289 - (44%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYR----PHDGQQLRTYCAGSL 151
            |...::|:...|.:...|       |..|.|...:::.|.|.|.::    .|       :|.|||
  Rat    12 PLASLVHAAPCPVKQRVG-------IVGGREASESKWPWQVSLRFKFSFWMH-------FCGGSL 62

  Fly   152 INNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHES 216
            |:.::|:||||||....   |....|||.:|   .......|.|          :.|....:|..
  Rat    63 IHPQWVLTAAHCVGLHI---KSPELFRVQLR---EQYLYYADQL----------LTVNRTVVHPH 111

  Fly   217 FGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSE----SSPV 277
            :.|.....||||:.|...|..|..|.|..||.  ..:.:.||.:..|.|||...:.|    ..|:
  Rat   112 YYTVEDGADIALLELENPVNVSTHIHPTSLPP--ASETFPSGTSCWVTGWGDIDSDEPLLPPYPL 174

  Fly   278 KMKLRVTYVEPGLCRRKYAS-------IVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVL 335
            | :::|..||..||.|||.:       :.::.|..||| |.:|.|||.|||||||:...:|.|:.
  Rat   175 K-QVKVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCA-GNTRSDSCQGDSGGPLVCKVKGTWLQ 237

  Fly   336 GGIVSFGLNCGSRFWPAVYTNVLSYETWI 364
            .|:||:|..|.....|.:||.|..|..||
  Rat   238 AGVVSWGEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 87/264 (33%)
Tryp_SPc 116..364 CDD:214473 85/262 (32%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 87/264 (33%)
Tryp_SPc 30..266 CDD:214473 85/262 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.