DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Tpsg1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:300 Identity:91/300 - (30%)
Similarity:130/300 - (43%) Gaps:54/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TTRARPNDEVIHSTLLPDRSICGGDIAYN---QITKGNETVLTEFAWMVLLE-YRPHDGQQLRTY 146
            :.|.:..|.:.:|  :...|.||.....|   :|..|:......:.|...|. ::.|       .
Mouse    56 SARGQYPDSLANS--VSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVH-------V 111

  Fly   147 CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEI 211
            |.|||::..:|:|||||.|.:..      |....|.|||...:.           .|....|:.|
Mouse   112 CGGSLLSPEWVLTAAHCFSGSVN------SSDYQVHLGELTVTL-----------SPHFSTVKRI 159

  Fly   212 RIHE-SFGTRLFWNDIALIRLAREVAYSPSIRPVCLPST-----VGLQNWQSGQAFTVAGWGRTL 270
            .::. |.|......||||::|:..||.|..::|||||..     .|:|.|       |.|||  .
Mouse   160 IMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCW-------VTGWG--Y 215

  Fly   271 TSESSPVK-----MKLRVTYVEPGLCRRKYASI--VVLGDSHLCAEGRSRGDSCDGDSGGPLMAF 328
            |.|..|:|     .:.:|:.|:...|.:.|.|.  .::....|||.|  .||:|..||||||:..
Mouse   216 TGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARG--PGDACQDDSGGPLVCQ 278

  Fly   329 HEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNI 368
            ..|.|...|:||:|..||....|.||..|.:|..||..:|
Mouse   279 VAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHI 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 83/264 (31%)
Tryp_SPc 116..364 CDD:214473 81/261 (31%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 83/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.