DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and TPSG1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:282 Identity:95/282 - (33%)
Similarity:121/282 - (42%) Gaps:56/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTY-CAGSLINNRYVVTAAHCVS 165
            |..|..||     :|..|:......:.|...|..|       |.: |.|||::.::|:|||||.|
Human    54 PQVSDAGG-----RIVGGHAAPAGAWPWQASLRLR-------RVHVCGGSLLSPQWVLTAAHCFS 106

  Fly   166 AATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHES----FGTRLFWNDI 226
            .:..      |....|.|||...:.           .|....|.:|.:|.|    .||.   .||
Human   107 GSLN------SSDYQVHLGELEITL-----------SPHFSTVRQIILHSSPSGQPGTS---GDI 151

  Fly   227 ALIRLAREVAYSPSIRPVCLPST-----VGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLR---V 283
            ||:.|:..|..|..|.|||||..     .|::.|       |.|||.|...|..|....||   |
Human   152 ALVELSVPVTLSSRILPVCLPEASDDFCPGIRCW-------VTGWGYTREGEPLPPPYSLREVKV 209

  Fly   284 TYVEPGLCRRKYASI--VVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCG 346
            :.|:...|||.|...  .:|....|||.|  .||:|..||||||:....|.||..|.||:|..||
Human   210 SVVDTETCRRDYPGPGGSILQPDMLCARG--PGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCG 272

  Fly   347 SRFWPAVYTNVLSYETWITQNI 368
            ....|.|||.|.:|..||.::|
Human   273 RPNRPGVYTRVPAYVNWIRRHI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 90/265 (34%)
Tryp_SPc 116..364 CDD:214473 88/262 (34%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 88/263 (33%)
Tryp_SPc 63..293 CDD:238113 90/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.