DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG30289

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:280 Identity:96/280 - (34%)
Similarity:140/280 - (50%) Gaps:33/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLL-EYRPHDGQQLRTYCAGSLINNR 155
            |:.|:...|:.:..|...|.....|..|.:|.:.|..||||: ..:|         |.||||..:
  Fly    18 NNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP---------CGGSLIARQ 73

  Fly   156 YVVTAAHCVSAATRARKGDVSFRVSVRLGEHNT-SAVVDCLNGRCLPEPVQIAVEEIRIHESFGT 219
            :|:|||||||...          :.||||::.| ..:..|||..|:|:...|:|:...:||::..
  Fly    74 FVLTAAHCVSFED----------LYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNG 128

  Fly   220 RLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVT 284
            ....|||||:|::..|.||..:||:||  .|| :..||...|||.|||.|...:.|.:.:...:.
  Fly   129 ITLQNDIALLRMSEAVEYSDYVRPICL--LVG-EQMQSIPMFTVTGWGETEYGQFSRILLNATLY 190

  Fly   285 YVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMA-FHEGVWVLG---GIVSFGL-N 344
            .::...|..|:..  ....|.:|| |....::|.|||||||.: ||.|..:|.   |:||:|. .
  Fly   191 NMDISYCNIKFNK--QADRSQICA-GSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSER 252

  Fly   345 CGSRFWPAVYTNVLSYETWI 364
            |.:.. ..|||||..:..||
  Fly   253 CAANV-AGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 91/256 (36%)
Tryp_SPc 116..364 CDD:214473 89/254 (35%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 89/254 (35%)
Tryp_SPc 42..271 CDD:238113 89/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.