DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG30288

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:262 Identity:80/262 - (30%)
Similarity:115/262 - (43%) Gaps:35/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 QITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFRV 179
            :|..|.:..:....|||.:....      :..|.||||..|:|:||.||:|          ...:
  Fly    42 RIDGGRDAGMESNPWMVRVMISG------KAVCGGSLITARFVLTAEHCIS----------PMYM 90

  Fly   180 SVRLGEHNT-SAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRP 243
            :|||||::| ..:.||.:..|.|....:.|:...:|.:.|     .||.|:|:.|.|.:|..:||
  Fly    91 NVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSNPG-----YDIGLLRMQRSVIFSNYVRP 150

  Fly   244 VC--LPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHL 306
            :|  |..|:| .|..|...|...|||.....|.........:..:....|.|....:.:   |::
  Fly   151 ICLILGKTLG-GNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSCERPGRPLDI---SYI 211

  Fly   307 CAEGRSRGDSCDGDSGGPLMAFH----EGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQN 367
            || |....|||.|||||||.|..    :|.....|:.|.||...|..  .:||||..:..||...
  Fly   212 CA-GSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGL--GIYTNVTHFTDWILDV 273

  Fly   368 IR 369
            |:
  Fly   274 IQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 79/257 (31%)
Tryp_SPc 116..364 CDD:214473 77/254 (30%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 77/255 (30%)
Tryp_SPc 45..270 CDD:238113 76/252 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.