DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG30088

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:285 Identity:93/285 - (32%)
Similarity:143/285 - (50%) Gaps:47/285 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DEVIHSTLLPDRSICGGDIAY-----NQITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLI 152
            ::|..:.|:|.   ||  ::|     .:|.:|.|.:|....:|..|.|      ....:|.|::|
  Fly    22 EQVAANFLIPS---CG--VSYESNVATRIVRGKEAMLKSAPFMAYLYY------SSEIHCGGTII 75

  Fly   153 NNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESF 217
            ::||::|||||:..           .:.||||||:.:...||..|.|.|...:..:.....::.|
  Fly    76 SSRYILTAAHCMRP-----------YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRF 129

  Fly   218 GTRLFWNDIALIRLAREVAYSPSIRPVCL---PSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKM 279
             .|...|||||::|:|.:.::..|:|:||   |:..  .|....|||   |||:|.|:.|:.|..
  Fly   130 -DRFLANDIALLKLSRNIRFNVHIQPICLILNPAAA--PNVHEFQAF---GWGQTETNHSANVLQ 188

  Fly   280 KLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLM--AFHEGVW--VLGGIVS 340
            ...:|..:...||...:..:.:  :.||. |....|:|.|||||||:  ..::|||  :..||||
  Fly   189 TTVLTRYDNRHCRSVLSMPITI--NQLCV-GFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVS 250

  Fly   341 FGLN-CGSRFWPAVYTNVLSYETWI 364
            ||.: |.|   |.|||.|.:|..||
  Fly   251 FGDDKCQS---PGVYTYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 87/257 (34%)
Tryp_SPc 116..364 CDD:214473 85/255 (33%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 85/256 (33%)
Tryp_SPc 45..273 CDD:238113 87/257 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.