DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and CG30082

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:315 Identity:102/315 - (32%)
Similarity:136/315 - (43%) Gaps:70/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VCCTP-------DTDYNTTRARPNDEVIHSTLLPDRSICGG---DIAYNQITKGNETVLTEFAWM 130
            ||.||       |.:..||...|          |...|.||   ||..|             .|:
  Fly    13 VCLTPKLRAQFIDPNCGTTINLP----------PTNRIVGGRTADIGSN-------------PWL 54

  Fly   131 VLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSFR-VSVRLGEHNTSAVVDC 194
            ..|    |....|  .|.|:||..|:|:|||||:.          ||. ::|||||::||..:||
  Fly    55 AYL----HKNSSL--VCTGTLITKRFVLTAAHCLH----------SFHLLTVRLGEYDTSTRIDC 103

  Fly   195 LNGRCLPEPVQIAVEEIRIHESFGTRL-FWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSG 258
            .:..|:|...:.:||...||..||.|. ..|||.|::|...|.|...|||:||....|...:.| 
  Fly   104 TSEFCIPTYEEYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPYSS- 167

  Fly   259 QAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGG 323
             .:..||||:.....::.|...:.:..::...|.|...:.:..|  ..|| |:.|.|:|.|||||
  Fly   168 -TYEAAGWGKIDLINTATVLQTVNLIRLDQSDCERSLRTSLSYG--QFCA-GQWRADTCSGDSGG 228

  Fly   324 PLMAFHEGVWVLG----GIVSFG-LNCGSRFWPAVYTNVLSYETWI------TQN 367
            ||........:..    ||||:| ..|..   |.|||.|.|:..||      |||
  Fly   229 PLSRKMSNGRITRTVQLGIVSYGHYLCRG---PGVYTYVPSFTNWILSITRWTQN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855 1/1 (100%)
Tryp_SPc 116..367 CDD:238113 85/263 (32%)
Tryp_SPc 116..364 CDD:214473 82/254 (32%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 88/268 (33%)
Tryp_SPc 40..274 CDD:238113 90/270 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.