DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and TPSD1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:227 Identity:72/227 - (31%)
Similarity:93/227 - (40%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVS------AATRARKGD 174
            |..|.|...:::.|.|.|..|   |.....:|.||||:.::|:||||||.      ||.|     
Human    38 IVGGQEAPRSKWPWQVSLRVR---GPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALR----- 94

  Fly   175 VSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVAYSP 239
                  |:|.|.:.     ....:.||      |..|.:|..|.......||||:.|...|..|.
Human    95 ------VQLREQHL-----YYQDQLLP------VSRIIVHPQFYIIQTGADIALLELEEPVNISS 142

  Fly   240 SIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLR---VTYVEPGLCRRKY------ 295
            .|..|.||.  ..:.:..|....|.|||....:...|....|:   |..||..||..:|      
Human   143 HIHTVTLPP--ASETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHT 205

  Fly   296 -ASIVVLGDSHLCAEGRSRGDSCDGDSGGPLM 326
             .|..::.|..||| |....|||.|||||||:
Human   206 GHSFQIVRDDMLCA-GSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 72/227 (32%)
Tryp_SPc 116..364 CDD:214473 72/227 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 72/227 (32%)
Tryp_SPc 38..240 CDD:214473 72/227 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.