DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and try-1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:265 Identity:89/265 - (33%)
Similarity:123/265 - (46%) Gaps:50/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NQITKGNETVLTEFAWMV-LLEYRPHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVSF 177
            :::..|:|:....:.|.| ||....|.      .|.||||:..:|:|||||.:...|...     
 Worm    56 HRLIGGSESSPHSWPWTVQLLSRLGHH------RCGGSLIDPNFVLTAAHCFAKDRRPTS----- 109

  Fly   178 RVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWN-------DIALIRLAREV 235
             .|||:|.|.        :|...|.    .|..:.||.      ::|       |.|::|:...|
 Worm   110 -YSVRVGGHR--------SGSGSPH----RVTAVSIHP------WYNIGFPSSYDFAIMRIHPPV 155

  Fly   236 AYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTL--TSESSPVKMKLRVTYVEPGLCRR--KYA 296
            ..|.:.||:||||...::|    :...|.|||.|:  :|.|:|...::.|..:....|..  .|.
 Worm   156 NTSTTARPICLPSLPAVEN----RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYI 216

  Fly   297 SIVVLGDSHLCAEGRSRG--DSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLS 359
            ..:.| .|.||| |.|.|  |||.||||||||...:|.|.|.|:||:|:.|.....|.||.||.|
 Worm   217 GRIHL-PSMLCA-GYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIGCARPGMPGVYGNVHS 279

  Fly   360 YETWI 364
            ..|||
 Worm   280 ASTWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 89/263 (34%)
Tryp_SPc 116..364 CDD:214473 87/261 (33%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 89/262 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.