DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Tpsb2

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:268 Identity:84/268 - (31%)
Similarity:119/268 - (44%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 ITKGNETVLTEFAWMVLLEYR----PHDGQQLRTYCAGSLINNRYVVTAAHCVSAATRARKGDVS 176
            |..|:|...:::.|.|.|.::    .|       :|.||||:.::|:||||||....   |....
Mouse    32 IVGGHEASESKWPWQVSLRFKLNYWIH-------FCGGSLIHPQWVLTAAHCVGPHI---KSPQL 86

  Fly   177 FRVSVR-----LGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVA 236
            |||.:|     .|:.                  .:::..|.:|..:.|.....|:||:.|...|.
Mouse    87 FRVQLREQYLYYGDQ------------------LLSLNRIVVHPHYYTAEGGADVALLELEVPVN 133

  Fly   237 YSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKL---RVTYVEPGLCRRKYASI 298
            .|..:.|:.||.  ..:.:..|.:..|.|||.....|..|....|   :|..||..||.|||.:.
Mouse   134 VSTHLHPISLPP--ASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTG 196

  Fly   299 VVLGDSH-------LCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTN 356
            :..||..       ||| |.:|.|||.|||||||:...:|.|:..|:||:|..|.....|.:||.
Mouse   197 LYTGDDFPIVHDGMLCA-GNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTR 260

  Fly   357 VLSYETWI 364
            |..|..||
Mouse   261 VTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 84/268 (31%)
Tryp_SPc 116..364 CDD:214473 82/266 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 84/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.