DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11313 and Klk1b1

DIOPT Version :9

Sequence 1:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:290 Identity:77/290 - (26%)
Similarity:123/290 - (42%) Gaps:69/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SICGGDIA---YNQITKGNETVLTEFAWMVLLEYRPHDGQQLRTY-CAGSLINNRYVVTAAHCVS 165
            |:.|.|.|   .::|..|.:.......|.|.: ||      .:.| |.|.|::..:|:|||||..
Mouse    11 SLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAV-YR------YKEYICGGVLLDANWVLTAAHCYY 68

  Fly   166 AATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWN------ 224
            .           :.:|.||::|..        :..|......|.:..:|..:...|..|      
Mouse    69 E-----------KNNVWLGKNNLY--------QDEPSAQHRLVSKSFLHPCYNMSLHRNRIQNPQ 114

  Fly   225 -----DIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVK------ 278
                 |:.|:||::....:..::|:.||:    :..:.|.....:|||..:     |||      
Mouse   115 DDYSYDLMLLRLSKPADITDVVKPIALPT----EEPKLGSTCLASGWGSII-----PVKFQYAKD 170

  Fly   279 ---MKLRVTYVEPGLCRRKYASIVVLGDSHLCAEGRSRG-DSCDGDSGGPLMAFHEGVWVLGGIV 339
               :.|::...|.  |.:.|...|.  |..|||..:..| |:|.|||||||:.  :|  ||.|:.
Mouse   171 LQCVNLKLLPNED--CDKAYVQKVT--DVMLCAGVKGGGKDTCKGDSGGPLIC--DG--VLQGLT 227

  Fly   340 SFGLN-CGSRFWPAVYTNVLSYETWITQNI 368
            |:|.| ||....|.|||.::.:.:||...:
Mouse   228 SWGYNPCGEPKKPGVYTKLIKFTSWIKDTL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 73/273 (27%)
Tryp_SPc 116..364 CDD:214473 71/270 (26%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 71/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.